SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8DHF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8DHF5
Domain Number - Region: 320-349
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0259
Family Rubredoxin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8DHF5
Sequence length 390
Comment (tr|Q8DHF5|Q8DHF5_THEEB) Tll2004 protein {ECO:0000313|EMBL:BAC09556.1} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tll2004 OC=Thermosynechococcus.
Sequence
MEKAFSYRFYPTTEQESLLRRTLGCVRLVYNRALAARTEAWYERKERLDYVQTSALLTKW
KKQDDLQFLNEVSSVPLQQALRHLQSAFSNFFAGRAKYPNFKKKRNGGSAEFTKSAFRWK
DGKVFLAKCNEPPNILWSRRLPDGVEPSTVTIRLNPAGQWYISLRFDDPRDLTLQPVDPS
VGLDVGMSSLITLSTGEKIANPKHFNRYYKRLRKAQRSLSRKQKGSRNWDKARLKVAKIH
QKISDSRKDHLHQLTTRLIRENQTIIIESLAVKNMVKNRQLARSISDAGWGELVRQLEYK
AQWYGRTLVKIDQWFPSSKRCGQCGHIVERLPLSVREWDCPKCGAHHDRDVNAAQNILAV
GHTVTVCGAGVRPDRHTSGGQLRRSRKSQK
Download sequence
Identical sequences Q8DHF5
TeR224 gi|22299547|ref|NP_682794.1| NP_682794.1.97157 197221.tll2004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]