SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8DI53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8DI53
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 4.05e-47
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 160-316
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.12e-30
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00046
Further Details:      
 
Domain Number 3 Region: 319-422
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 1.83e-29
Family Glutamyl tRNA-reductase dimerization domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8DI53
Sequence length 426
Comment (sp|Q8DI53|HEM1_THEEB) Glutamyl-tRNA reductase {ECO:0000255|HAMAP-Rule:MF_00087} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tll1738; OC=Thermosynechococcus.
Sequence
MNIAVIGLSHKTAPVDVREKLSVPEDVRERALQHLCGYAHIQEATILSTCNRLEIYIVTS
DTEVGVREVHQFLSEWSHIPLPQLRPYLFILLHQDAVMHLMRVASGLDSLVIGEGQILSQ
VKRCHQLGQQYKSIGPILNRVFTGAIAAGKRVRTETSIGTGAVSISSAAVELADLRLQNL
QNCRIAVVGAGKMSRLVVQHLIARGVKEIRIINRSLERAQELAQQFPEVRFELFTMTDLL
PIVAAMDLVFTSTAATEPLLDRDNLGAVLVGDRSLAIIDISVPRNVHANVTELGTVQLFN
VDDLQAVVAQNQEARRQLAQEAEGILEEELETFLAWWHALETVPIIRSLRQKMEAIRTQE
LEKALSRLGSEFADKHQGVIEAMTRTIINKILHDPTVQLQSQRDLESRQRAMQTLQDLFN
LEPIEA
Download sequence
Identical sequences Q8DI53
NP_682528.1.97157 197221.tll1738 gi|22299281|ref|NP_682528.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]