SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8DIH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8DIH2
Domain Number 1 Region: 12-232
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.06e-59
Family PP-loop ATPase 0.00018
Further Details:      
 
Domain Number 2 Region: 212-316
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 3.14e-19
Family MesJ substrate recognition domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8DIH2
Sequence length 344
Comment (sp|Q8DIH2|TILS_THEEB) tRNA(Ile)-lysidine synthetase {ECO:0000255|HAMAP-Rule:MF_01161} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tlr1616; OC=Thermosynechococcus.
Sequence
MWGIHHARLHTTLKTQQWLPLGSRILIALSGGQDSVCLTRLLLDLQPHWQWSLVAVHCDH
RWRADSTANANFVQQLAQKWHLPCEVVSAPDLPKTEAAARSWRYQVFESVAKALDCTHVV
TAHTQSDRAESLLLHLLRGTSPDGLATLLPSRSLGAIQLVRPLLGMTRAQTAAFCQAYGL
PIWQDETNHNLEYRRNRLRLELIPYLQQHFNPNVEEALAQTAELLASDRAYFEAEVERLA
PTVLREHPPALDRLRLREFPLALQRRLIQCFLRQHLKRGLNFRVIEAVRALMTTGNGSQT
ASLPGGQHLRVCGRWIELVRPMPPPPAPVPPDPGERSPPPSPLY
Download sequence
Identical sequences Q8DIH2
197221.tlr1616 gi|22299159|ref|NP_682406.1| NP_682406.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]