SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8DK28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8DK28
Domain Number 1 Region: 109-284
Classification Level Classification E-value
Superfamily alpha/beta knot 2.51e-47
Family SpoU-like RNA 2'-O ribose methyltransferase 0.000049
Further Details:      
 
Domain Number 2 Region: 41-118
Classification Level Classification E-value
Superfamily L30e-like 2.94e-18
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8DK28
Sequence length 295
Comment (tr|Q8DK28|Q8DK28_THEEB) Tll1042 protein {ECO:0000313|EMBL:BAC08595.1} KW=Complete proteome; Reference proteome OX=197221 OS=Thermosynechococcus elongatus (strain BP-1). GN=tll1042 OC=Thermosynechococcus.
Sequence
MTEKPRPRKKNRPPAKRPPRLQRRTPAQPLQKAPPTAPAADAPELLYGRHAVLSALESGR
PCNRIWVIPSLRYDPRFHQRLNEAKQQGAIIDTVTPERLDQLCQRGRHQGIAIQVAAYNY
WSLEDLLAKAATVNQPVLLAADGITDPQNLGAMIRTAEALGMQGVIIPQRRAVGITATVA
KAAAGALEYLPVARVINLNQALETLKAAGYWIYGLSEHGAVPLPKITFDRPTVFVVGSEG
EGISLQTQKHCDEIVAIPLAGRTNSLNASVAVGIALYEINCQRSPAWDLTQEPRG
Download sequence
Identical sequences Q8DK28
197221.tll1042 gi|22298586|ref|NP_681833.1| NP_681833.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]