SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8GUT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8GUT5
Domain Number 1 Region: 204-281
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.97e-18
Family N-acetyl transferase, NAT 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8GUT5
Sequence length 288
Comment (tr|Q8GUT5|Q8GUT5_ARATH) Acyl-CoA N-acyltransferases (NAT) superfamily protein {ECO:0000313|EMBL:AEC05996.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At2g06025 OC=Arabidopsis.
Sequence
MSTISIHRTETLRITHARSRIFRQRYRRTIPLWKLTINSRSSDTSKKEELSVQISIPPQV
DQSRPEGLRFDRLQPPEPEFGHEDRFEFGKFVAREAMLDEEYWTAAWLRAESHWEDRSNE
RYVDNYKRKFAEQEFNAIKRRCKGMQGQKCSCIVAVKKEEKHIKRSVIKSVVGTLDLSIR
YFLQGETFPGEKVKSQLFCSINQEGSNRYGYIANLCVAKSARRQGIACNMLRFAVESARL
SGVEQVYVHVHKNNSVAQELYQKTGFKIVETGKFESLDDDTYLLQYTS
Download sequence
Identical sequences Q8GUT5
3702.AT2G06025.1-P AT2G06025.1 AT2G06025.1 NP_001318205.1.80155 NP_001324281.1.80155 NP_671784.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]