SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8GYM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8GYM4
Domain Number 1 Region: 234-337
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-22
Family B3 DNA binding domain 0.007
Further Details:      
 
Domain Number 2 Region: 129-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.02e-20
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 3 Region: 3-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-19
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 4 Region: 381-483
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-18
Family B3 DNA binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8GYM4
Sequence length 490
Comment (sp|Q8GYM4|REM14_ARATH) Protein REPRODUCTIVE MERISTEM 14 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=REM14; OC=Arabidopsis.
Sequence
MANQHFFKPLLPGFHTHLRIPVAFFLKNIEGRYEQKTAELRSDASKITWEVKIDGQRLTD
GWKEFALSHDLRIGDIVVFRQERDMSFHVTMLGPSCCEIQYGSCSDEERNLEKKKNPNGE
AKSSSLDPSCFSANVAPSSLRYDLMLFPMGFVRENGVVGSGKIVLMNEKGRSWNFNLRQK
PSCGTVYVRGGWVSFCDANGLQAGDIYTFKLIKRGGTLVLRLLPKGAESCSLDPSCFVAN
VAPSTLRYDTLYLPKRFMRENGVDKRRGEMILMNEKGKSWTLDLKLKKSCGTSLIRRGWR
SFCSANGLRAGSIITFKLIKKSGTLVLCLLSNEPEEEVCSEANEVESLSTDQESHEESSH
NEKISRRKEKKGRMIWKASSSPSENRFVTLNLTPYNILRSALRLPIPFTRMNGINEETKM
TLLDKHGMKWLTTLRLVDYKRKRLGMVGGWKGFIQANGVKANESIMLELIWEEETSCVLK
FCSKVKLAIK
Download sequence
Identical sequences A0A178VUI0 Q8GYM4
AT2G24645.1 AT2G24645.1 NP_001189594.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]