SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8GZ42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8GZ42
Domain Number 1 Region: 895-1040
Classification Level Classification E-value
Superfamily SET domain 8.9e-42
Family Histone lysine methyltransferases 0.0061
Further Details:      
 
Domain Number 2 Region: 215-324
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.45e-17
Family PWWP domain 0.0033
Further Details:      
 
Domain Number 3 Region: 607-672
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000188
Family PHD domain 0.0099
Further Details:      
 
Domain Number 4 Region: 414-470
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000377
Family PHD domain 0.0051
Further Details:      
 
Weak hits

Sequence:  Q8GZ42
Domain Number - Region: 712-749
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0204
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8GZ42
Sequence length 1043
Comment (sp|Q8GZ42|ATX5_ARATH) Trithorax-homolog protein 5 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=MYN8.4; OC=Arabidopsis.
Sequence
MIIKRKLKTLKRCNSTNEEDDIVRKKRKVNLNGGGSGGDYYYPLNLLGEIGAGIVPGKNG
FSVSLCKQVSCSPKVEVVEEEEEEEEIKSTRLVSRPPLVKTSRGRVQVLPSRFNDSVIEN
WRKDNKSSGEEREEEIEEEACRKEKVKVSSNHSLKIKQQETKFTPRNYKYSSSSALCGEI
DDEDKCEEIVRYGNSFEMKKQRYVDDEPRPKKEGVYGPEDFYSGDLVWGKSGRNEPFWPA
IVIDPMTQAPELVLRSCIPDAACVMFFGHSGTENERDYAWVRRGMIFPFVDYVERLQEQS
ELRGCNPRDFQMALEEALLADQGFTEKLMQDIHMAAGNQTFDDSVYRWVEEAAGSSQYLD
HVAPSQDMKKYRNPRACVGCGMVLSFKMAQKMKALIPGDQLLCQPCSKLTKPKHVCGICK
RIWNHLDSQSWVRCDGCKVWIHSACDQISHKHFKDLGETDYYCPTCRTKFDFELSDSEKP
DSKSKLGKNNAPMVLPDKVIVVCSGVEGIYFPSLHLVVCKCGSCGPERKALSEWERHTGS
KAKNWRTSVKVKSSKLPLEEWMMKLAEFHANATAAKPPKRPSIKQRKQRLLSFLREKYEP
VNVKWTTERCAVCRWVEDWDYNKIIICNRCQIAVHQECYGTRNVRDFTSWVCKACETPEI
KRECCLCPVKGGALKPTDVETLWVHVTCAWFQPEVCFASEEKMEPALGILSIPSSNFVKI
CVICKQIHGSCTQCCKCSTYYHAMCASRAGYRMELHCLEKNGRQITKMVSYCSYHRAPNP
DTVLIIQTPSGVFSAKSLVQNKKKSGTRLILANREEIEESAAEDTIPIDPFSSARCRLYK
RTVNSKKRTKEEGIPHYTGGLRHHPSAAIQTLNAFRHVAEEPKSFSSFRERLHHLQRTEM
ERVCFGRSGIHGWGLFARRNIQEGEMVLEYRGEQVRGIIADLREARYRREGKDCYLFKIS
EEVVVDATEKGNIARLINHSCMPNCYARIMSVGDDESRIVLIAKTTVASCEELTYDYLFD
PDEPDEFKVPCLCKSPNCRKFMN
Download sequence
Identical sequences Q8GZ42
AT5G53430.1 AT5G53430.1 3702.AT5G53430.1-P NP_200155.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]