SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8IWW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IWW6
Domain Number 1 Region: 649-844
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000428
Further Details:      
 
Domain Number 2 Region: 466-577
Classification Level Classification E-value
Superfamily PH domain-like 1.38e-19
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 3 Region: 11-94
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000387
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 259-298
Classification Level Classification E-value
Superfamily WW domain 0.00000000994
Family WW domain 0.0022
Further Details:      
 
Domain Number 5 Region: 363-391
Classification Level Classification E-value
Superfamily WW domain 0.0000208
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8IWW6
Sequence length 846
Comment (sp|Q8IWW6|RHG12_HUMAN) Rho-type GTPase-activating protein 12 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARHGAP12; OC=Catarrhini; Hominidae; Homo.
Sequence
MKMADRSGKIIPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPDENSK
AFYVPAQYVKEVTRKALMPPVKQVAGLPNNSTKIMQSLHLQRSTENVNKLPELSSFGKPS
SSVQGTGLIRDANQNFGPSYNQGQTVNLSLDLTHNNGKFNNDSHSPKVSSQNRTRSFGHF
PGPEFLDVEKTSFSQEQSCDSAGEGSERIHQDSESGDELSSSSTEQIRATTPPNQGRPDS
PVYANLQELKISQSALPPLPGSPAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTR
DASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYT
NEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKW
RHSTIVLDTNDKESPTASKPCFPENESSPSSPKHQDTASSPKDQEKYGLLNVTKIAENGK
KVRKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGATIEMASKDKSSKK
NVFELKTRQGTELLIQSDNDTVINDWFKVLSSTINNQAVETDEGIEEEIPDSPGIEKHDK
EKEQKDPKKLRSFKVSSIDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKDQVFGSNLAN
LCQRENGTVPKFVKLCIEHVEEHGLDIDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKW
EDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVAAVKDLIRQLPKPNQDTM
QILFRHLRRVIENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLEL
SSIFGR
Download sequence
Identical sequences Q8IWW6
gi|26986534|ref|NP_060757.4| ENSP00000345808 ENSP00000364394 NP_060757.4.87134 NP_060757.4.92137 9606.ENSP00000345808 ENSP00000345808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]