SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8N4B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8N4B1
Domain Number 1 Region: 14-127
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-28
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8N4B1
Sequence length 249
Comment (sp|Q8N4B1|SESQ1_HUMAN) 27 kDa inositol polyphosphate phosphatase-interacting protein A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FAM109A; OC=Catarrhini; Hominidae; Homo.
Sequence
MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGV
IILEGCTVELVEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVV
RELEQQLAAVRGGGGMALPQPQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSA
LPPKENGCAVWSTEATFRPGPEPPPPPPRRRASAPHGPLDMAPFARLHECYGQEIRALRG
QWLSSRVQP
Download sequence
Identical sequences Q8N4B1
ENSP00000376426 ENSP00000447353 ENSP00000449994 9606.ENSP00000354461 ENSP00000447353 ENSP00000449994 gi|24432056|ref|NP_653272.2| gi|295821167|ref|NP_001171468.1| NP_001171468.1.87134 NP_001171468.1.92137 NP_653272.2.87134 NP_653272.2.92137 XP_006719320.1.92137 XP_011536278.1.92137 XP_016874372.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]