SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8N5V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8N5V2
Domain Number 1 Region: 254-474
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-54
Family DBL homology domain (DH-domain) 0.0000854
Further Details:      
 
Domain Number 2 Region: 465-602
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 3 Region: 600-674
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-17
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8N5V2
Sequence length 710
Comment (sp|Q8N5V2|NGEF_HUMAN) Neuronal guanine nucleotide exchange factor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NGEF; OC=Catarrhini; Hominidae; Homo.
Sequence
METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIK
RNSIFNRSIRRKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRMPPCRTAMQT
DPGAQEMSESSSTPGNGATPEEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGLLYQ
EYRDKSTLQEIETRRQQDAEIEDNTNGSPASEDTPEEEEEEEEEEEPASPPERKTLPQIC
LLSNPHSRFNLWQDLPEIRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHFM
ENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAADHF
SVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLK
LLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKS
VPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQVF
DSAPRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNR
RTKFVSFTSRLLDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQER
GWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences Q8N5V2
ENSP00000264051 9606.ENSP00000264051 ENSP00000264051 NP_062824.2.87134 NP_062824.2.92137 XP_011509225.1.92137 gi|166197688|ref|NP_062824.2| ENSP00000264051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]