SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8NR77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8NR77
Domain Number 1 Region: 301-321,361-596
Classification Level Classification E-value
Superfamily HAD-like 7.28e-52
Family Meta-cation ATPase, catalytic domain P 0.00049
Further Details:      
 
Domain Number 2 Region: 116-211
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-23
Family Calcium ATPase, transduction domain A 0.0039
Further Details:      
 
Domain Number 3 Region: 63-114,212-297,373-380
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000183
Family Calcium ATPase, transmembrane domain M 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8NR77
Sequence length 625
Comment (tr|Q8NR77|Q8NR77_CORGL) Cation transport ATPases {ECO:0000313|EMBL:BAB98569.1} KW=Complete proteome; Reference proteome OX=196627 OS=LMG 3730 / NCIMB 10025). GN=Cgl1176 OC=Corynebacterium.
Sequence
MKTWKTWGVVGASGLLIILSWLSSSSPMLADAFMIAAAIVAGWPIAQSAYQALRIRMVSI
DLLVVVAAVGAMFINNYWESAAVTFLFALGKALERATMNRTRKALSDLVDAAPETATRLN
ADDSTEVVELWELEPGDIVLVRNGEQIPVDGNVIAGVGGIDESNITGESMPAEKGQGSDV
YAGTWLRSGVLRVEATGIGSDSTLAKIIHRVEDAQDDKARTQTFLEKFSKWYTPGVMIAA
AVVGLITWDVELALTLLVIGCPGALVISIPVSIVAGIGRAARDGVLIKGGEYLETAAKVD
VVVVDKTGTLTTGRPELTDVEVIEPAYSQGEVLELAARAETASEHPLADAIIRGAQDRGL
STTLVEAAENITGRGIIANVDGQAVAVGSAELLDHEPDSTRILELNAEGKTAMFVGVNGH
AIGIVAVADAVRSDSASAIESLHKAGIQVVMATGDAHRVAQNVASKLGVDEVYSELLPEQ
KLELVRDLQAAGKTVAMVGDGVNDTPALAAADIGVAMGVAGSPAAIETADIALMADRLPR
LAHAVTLAKRTVRTMRINILIALATVMVLLAGVLFGGVTMSVGMLVHEASVLLVISIAML
LLRPTLKEDAAQASDIKRSEIQQIA
Download sequence
Identical sequences A0A2H5HXF3 Q8NR77
NP_600402.1.3765 WP_011014176.1.21641 WP_011014176.1.3871 WP_011014176.1.4395 WP_011014176.1.80527 gi|62390064|ref|YP_225466.1| gi|530315337|ref|YP_008401301.1| gi|62390064|ref|YP_225466.1| gi|62390064|ref|YP_225466.1| NYSGXRC-22053a 196627.cg1329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]