SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8R6Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8R6Z8
Domain Number 1 Region: 7-122
Classification Level Classification E-value
Superfamily AF1862-like 1.28e-30
Family Cas Cmr5-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8R6Z8
Sequence length 135
Comment (tr|Q8R6Z8|Q8R6Z8_CALS4) Uncharacterized protein {ECO:0000313|EMBL:AAM25752.1} KW=Complete proteome; Reference proteome OX=273068 OS=JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis). GN=TTE2632 OC=Thermoanaerobacteraceae; Caldanaerobacter.
Sequence
MVEGLKVKTLEQERASFCLKEIEELPKGKDKRDKYKTNARRLPAFIVSNGLIPTLAFYKS
KEETKPVYDTLNKWLQKRGYISENKDALDELVDKDFQILRLATTEILALANWLKRTVEIE
IKEEKDDLSGEREEQ
Download sequence
Identical sequences Q8R6Z8
273068.TTE2632 WP_011026627.1.99938 gi|20808977|ref|NP_624148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]