SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8SYG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8SYG2
Domain Number 1 Region: 312-384
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000261
Family PCI domain (PINT motif) 0.023
Further Details:      
 
Weak hits

Sequence:  Q8SYG2
Domain Number - Region: 195-226
Classification Level Classification E-value
Superfamily TPR-like 0.0333
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8SYG2
Sequence length 445
Comment (sp|Q8SYG2|CSN3_DROME) COP9 signalosome complex subunit 3 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CSN3; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGSALENYVNQVRTLSASGSYRELAEELPESLSLLARNWSILDNVLETLDMQQHSLGVLY
VLLAKLHSASTANPEPVQLIQLMRDFVQRNNNEQLRYAVCAFYETCHLFTEFVVQKNLSI
LGIRIISRAIDQIRQLETQLTPIHADLCLLSLKAKNFSVVLPYLDADITDISTVAAECKT
QQQQQSQHADANNDAKYFLLYFYYGGMIYTAVKNYERALYFFEVCITTPAMAMSHIMLEA
YKKFLMVSLIVEGKIAYIPKNTQVIGRFMKPMANHYHDLVNVYANSSSEELRIIILKYSE
AFTRDNNMGLAKQVATSLYKRNIQRLTKTFLTLSLSDVASRVQLASAVEAERYILNMIKS
GEIYASINQKDGMVLFKDDPEKYNSPEMFLNVQNNITHVLDQVRQINKMEEEIILNPMYV
KKALGSQDDDLTSQHPKTFSGDPTD
Download sequence
Identical sequences Q8SYG2
NP_524190.2.81976 7227.FBpp0077927 FBpp0077927 FBpp0077927 FBpp0077927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]