SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8T4A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8T4A3
Domain Number 1 Region: 33-144,455-549
Classification Level Classification E-value
Superfamily TPR-like 0.0000000246
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8T4A3
Sequence length 579
Comment (tr|Q8T4A3|Q8T4A3_DROME) CG7634 {ECO:0000313|EMBL:AAF51747.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG7634 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MTSIIPPGSLVPQAQGVEAAVPVWFKMDWSPEIEQGIYKDWGTYYSRRRRENLGMYYFDK
ALKLGPADFTTLYRRSQSKRKNAQADGALKDSLEAKRLLKNLQRYDAPINLEVCDALYEL
NQLENAKAELHDNTRLFTGNKTKMFEQRLVVVDENIEDACGPSMTQYISDKEKLIVHLKE
VQNKYKPDTRPLWKILKEQEKCDVLSIPEIEEEMLSPLEIARRSRAFDVFNQMFIDRSWH
DVIFLKHVRKNPNLLLNQCKNSTEYLQTLSTKKYDEIKSFLKILEARSPMYNIRYQKFTN
KKLMDKFRQEYLFRVQYQTRRNMISALRSIRYLRKTKSLTKLTSYVEEVMGDYVVKKTNR
IMPWKFEFINEVYNILALAYVDQYTLPKNFRFSEKNALLRLLRFPMDKSKEVKHFVFGDR
TTHQGSETVDPALTKSRLMGNRLENRMNFAKYPIEKSYLLHQMAEIHLKSHRFDECCFSA
RKSIEEAKKCNSYIWQFLCYLLIIKANAALHKVERTSEALDLALKISKELKEKHIHNFLT
ACIHCNEEEFIVKKQSIFANSRRESEKSVYSSLSVRHSN
Download sequence
Identical sequences Q8T4A3
FBpp0078027 FBpp0078027 7227.FBpp0078027 FBpp0078027 NP_649332.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]