SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8TBY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8TBY9
Domain Number 1 Region: 249-407,460-486,601-774
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.26e-33
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 
Domain Number 2 Region: 691-922
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-16
Family WD40-repeat 0.019
Further Details:      
 
Domain Number 3 Region: 980-1099
Classification Level Classification E-value
Superfamily EF-hand 0.0000000333
Family Calmodulin-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8TBY9
Sequence length 1149
Comment (sp|Q8TBY9|CF251_HUMAN) WD repeat-containing protein 66 {ECO:0000305} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CFAP251 OC=Catarrhini; Hominidae; Homo.
Sequence
MSDAAEAPREATGENGETEMKEEEEPNPNYKEVEDPQQESKDDTIAWRESQEEERKTGEE
EGEEEGKEDKKIVMEETEEKAGEVQEKEASGIQEETTVEPQEVTASMIRLETQITDSQSI
TSGIFPKTQRGSKSKLSLQLEDAETDELLRDLSTQIEFLDLDQISPEEQQISSPERQPSG
ELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLVSSTTEDILFQK
DKSTPVYPLTMTWSFGWNSSLPVYYIREERQRVLLYVCAHTAIIYNVFRNNQYHLQGHAN
IISCLCVSEDRRWIATADKGPDCLVIIWDSFTGIPVHTIFDSCPEGNGIMAMAMTHDAKY
LATISDAEVQKVCIWKWTLAVETPACTLELPTEYGVQNYVTFNPTNNKELVSNSKTRAIY
YAWYEERDTLAHSAPLLTEKTFNKLVGKFSQSIFHLNLTQILSATMEGKLVVWDIHRPPS
SASTFLGFPYIKPCKLVHLQKEGITVLTTIDSYIVTGDIKGNIKFYDHTLSIVNWYSHLK
LGAIRTLSFSKTPATPPTEKSNYPPDCTLKGDLFVLRNFIIGTSDAAVYHLTTDGTKLEK
LFVEPKDAICAISCHPYQPLIAIGSICGMIKVWNYENKQYLFSRVFEKGLGVQSLTYNPE
GALLGAGFTEGTVYILDAMSLENESPEPFKYSRTSVTHISFSHDSQYMATADRSFTVAVY
MLVVRNGQRVWEYLARLRSHRKSIRSLLFGVYLDSNEPRLLSLGTDRLLIEYDLLRSYKD
HLEVLDIHHTDQGCYPTCMVWYPPLTRELFLLICNSGYKVKLFNATTKMCRKTLLGPAYG
SPIEQTQVLPVRSMAELQKRYLVFINRDKVGLQILPVDGNPHKTSAIVCHPNGVAGMAVS
YDGCYAFTAGGHDRSVVQWKITLSVLEAAVSLGGEDLTPFYGLLSGGREGKFYRELEDYF
YYSQLRSQGIDTMETRKVSEHICLSELPFVMRAIGFYPSEEKIDDIFNEIKFGEYVDTGK
LIDKINLPDFLKVYLNHKPPFGNTMSGIHKSFEVLGYTNSKGKKAIRREDFLRLLVTKGE
HMTEEEMLDCFASLFGLNPEGWKSEPATCSVKGSEICLEEELPDEITAEIFATEILGLTI
SEDSGQDGQ
Download sequence
Identical sequences Q8TBY9
ENSP00000288912 gi|145279222|ref|NP_653269.3| NP_653269.3.87134 NP_653269.3.92137 ENSP00000288912 9606.ENSP00000288912 ENSP00000288912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]