SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8TWC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8TWC8
Domain Number 1 Region: 28-145
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.19e-19
Family MJ1460-like 0.031
Further Details:      
 
Domain Number 2 Region: 160-301
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 9.94e-17
Family MJ1460-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8TWC8
Sequence length 323
Comment (tr|Q8TWC8|Q8TWC8_METKA) Predicted metabolic regulator containing two V4R domains {ECO:0000313|EMBL:AAM02320.1} KW=Complete proteome; Reference proteome OX=190192 OS=100938). GN=MK1107 OC=Methanopyrus.
Sequence
MIDDGFSPESLRERAEEAGSVFTAEELLATNKMVMMALYSLGGERSCASVFRAGRMLAGF
FGVETLEDALHTFCELTGADYDLDRNYVAIESCPECLGYVNAEGAVCNFLRGFISRAAEH
ELGEVVSVAQVACEATGDRRCEFILGERGEVGGFDTEVDEMTAEDIEIVMSADGRDAVEV
AAFKIASEGLLRCALSDVARPMFFRAGRLYARAFINAFDPEDPDELIGHVEEISGSSYSL
EGDRFIVEKCLECAGMPFKEPICHAVRGALAETLEHWNVPFKDLVEVRCAAEEDEVVGTC
VVKARGVIWKAKRVVDAVKRAFH
Download sequence
Identical sequences Q8TWC8
190192.MK1107 gi|20094543|ref|NP_614390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]