SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8U1Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8U1Z9
Domain Number 1 Region: 157-274
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.56e-32
Family Homoserine kinase 0.0032
Further Details:      
 
Domain Number 2 Region: 1-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-29
Family GHMP Kinase, N-terminal domain 0.0000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8U1Z9
Sequence length 292
Comment (sp|Q8U1Z9|KHSE_PYRFU) Homoserine kinase {ECO:0000255|HAMAP-Rule:MF_00384} KW=Complete proteome; Reference proteome OX=186497 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1). GN=thrB OC=Pyrococcus.
Sequence
MKVYAPATIANFGPGFDVFGLAIETPRDTVIAKESDDFRIEVEGYKVPENDENVALVAAK
ALFKLVGEEGGIYLKLKKGIRPKSGLGSSGASSIAGAVAAARILGVEDDEIIIRAALEGE
RKASGSPHGDNVVPSYYGNFTIVESLNPLRVHNIEVDFKVVVILPSVEVPTSEARKVLPK
KVPLKDAVKNIALASSLVLALKEGNLEEVGRLLEDHLALPYRLSLVPWFPKVKEAAKEAG
AYGVMISGSGPAVFALGENLKEIGKAMKEAFESFGIEAEYWVTKVGRGAKWC
Download sequence
Identical sequences I6UYV8 Q8U1Z9
WP_011012191.1.13913 WP_011012191.1.59273 186497.PF1054 gi|18977426|ref|NP_578783.1| gi|397651561|ref|YP_006492142.1| Pfu-1009080-001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]