SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8WV90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8WV90
Domain Number 1 Region: 59-138
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.42e-24
Family Cystathionine synthase-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8WV90
Sequence length 189
Comment (tr|Q8WV90|Q8WV90_HUMAN) NFS1 nitrogen fixation 1 homolog (S. cerevisiae) {ECO:0000313|EMBL:AAH18471.1} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NFS1 OC=Catarrhini; Hominidae; Homo.
Sequence
MLLRAAWRRAAVAVTAAPGPKPAAPTRGLRLRVGDRAPQSAVPADTAAAPEVGPVLRPLY
MDVQATTPLDPRVLDAMLPYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPRE
IIFTSGATESNNIAIKTESHSVIQAGVQWHDLDSLQAPPPGFTPFSCLSLLSSWDYRRPP
PHPANFLYF
Download sequence
Identical sequences Q8WV90
ENSP00000304740 ENSP00000304740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]