SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8XHL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8XHL9
Domain Number 1 Region: 6-379
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.38e-126
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000077
Further Details:      
 
Domain Number 2 Region: 363-465
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.93e-36
Family Anticodon-binding domain of Class II aaRS 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8XHL9
Sequence length 467
Comment (sp|Q8XHL9|SYG_CLOPE) Glycyl-tRNA synthetase {ECO:0000255|HAMAP-Rule:MF_00253} KW=Complete proteome; Reference proteome OX=195102 OS=Clostridium perfringens (strain 13 / Type A). GN=CPE2464; OC=Clostridium.
Sequence
MAVEKTMDKIVALCKNRGFIFPGSEIYGGLANSWDYGPLGVEFKNNVKRAWWKKFVQESK
YNVGLDSAILMNREVWVASGHVGGFSDPLMDCKECKARFRADKLVEDHMTANGAEVATAD
GWSNEELMDYITKNNIVCPKCGKLNYTDIRKFNLMFKTFQGITEDSKNEVYLRPETAQGI
FVNFKSVQRTTRKKVPFGIAQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGTDLEWF
NFWKDSCWNFLLNLGMKEENIRMRDHGEEELSFYSNATSDIEYLFPFGWGELWGIADRTD
YDLNKHAEHSGQDMTYLDPTTNEKYVPYVIEPSLGADRVALAFLVEAYDEEELEGANGKV
DVRTVMHLHPALAPFKAAILPLSKKLSEKADEVYAELSKHFNVDYDETGSIGKRYRRQDE
IGTPFCITVDFDTLEDGCVTVRDRDNMEQQRVKIEDVRAIIEKSLEF
Download sequence
Identical sequences A0A0H2YNR2 A0A140GTN9 B1BHC5 B1BV63 B1R9X5 B1V4P8 Q0SQ87 Q8XHL9
195102.CPE2464 195103.CPF_2779 289380.CPR_2465 gi|110803756|ref|YP_699720.1| WP_003450306.1.100517 WP_003450306.1.10161 WP_003450306.1.1075 WP_003450306.1.13323 WP_003450306.1.1394 WP_003450306.1.14338 WP_003450306.1.17789 WP_003450306.1.2058 WP_003450306.1.20964 WP_003450306.1.22226 WP_003450306.1.23119 WP_003450306.1.24595 WP_003450306.1.27257 WP_003450306.1.27360 WP_003450306.1.27537 WP_003450306.1.28470 WP_003450306.1.28529 WP_003450306.1.29129 WP_003450306.1.29428 WP_003450306.1.30163 WP_003450306.1.31832 WP_003450306.1.3228 WP_003450306.1.32463 WP_003450306.1.39851 WP_003450306.1.4345 WP_003450306.1.4402 WP_003450306.1.44743 WP_003450306.1.48074 WP_003450306.1.4818 WP_003450306.1.50147 WP_003450306.1.50713 WP_003450306.1.52260 WP_003450306.1.5234 WP_003450306.1.52659 WP_003450306.1.64066 WP_003450306.1.66593 WP_003450306.1.67534 WP_003450306.1.68380 WP_003450306.1.76352 WP_003450306.1.78174 WP_003450306.1.83225 WP_003450306.1.85755 WP_003450306.1.87374 WP_003450306.1.90682 WP_003450306.1.93653 WP_003450306.1.96543 WP_003450306.1.98368 WP_003450306.1.99566 gi|110798906|ref|YP_697152.1| gi|18311446|ref|NP_563380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]