SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8YNV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8YNV9
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.38e-18
Family Ribosomal protein L33p 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8YNV9
Sequence length 64
Comment (sp|Q8YNV9|RL33_NOSS1) 50S ribosomal protein L33 {ECO:0000255|HAMAP-Rule:MF_00294} KW=Complete proteome; Reference proteome OX=103690 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576). GN=asl4452; OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MAKSKGARIIVTLECTECRTNPDKRSPGVSRYTSTKNRRNTTNRLELKKFCTHCNKHTVH
KEIK
Download sequence
Identical sequences A0A1Z4V3C7 K7WN05 Q3MDJ2 Q8YNV9
WP_010998585.1.33676 WP_010998585.1.44637 WP_010998585.1.48885 WP_010998585.1.50365 WP_010998585.1.60463 WP_010998585.1.77557 WP_010998585.1.86490 gi|17231944|ref|NP_488492.1| gi|75907543|ref|YP_321839.1| gi|414079581|ref|YP_007001005.1| 103690.asl4452 240292.Ava_1320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]