SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q8YPJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8YPJ5
Domain Number 1 Region: 87-166
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.57e-24
Family Translational machinery components 0.00033
Further Details:      
 
Domain Number 2 Region: 15-83
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.83e-19
Family Ribosomal S5 protein, N-terminal domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8YPJ5
Sequence length 174
Comment (sp|Q8YPJ5|RS5_NOSS1) 30S ribosomal protein S5 {ECO:0000255|HAMAP-Rule:MF_01307} KW=Complete proteome; Reference proteome OX=103690 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576). GN=all4199; OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MATGRRKANRTKKEETNWQERVIQIRRVSKVVKGGKKLSFRAIVVVGNERGQVGVGVGKA
SDVIGAVKKGVADGKKHLIDIPITKSNSIPHPIDGVGGGAKVMMRPAAPGTGVIAGGAVR
TVLELAGVRNVLAKQLGSNNPLNNARAAVNALSTLRTLAEVAEDRGIAIEKLYI
Download sequence
Identical sequences A0A1W5CGM5 A0A1Z4KLH1 Q3MFA5 Q8YPJ5
103690.all4199 240292.Ava_0707 WP_010998337.1.33676 gi|17231691|ref|NP_488239.1| gi|75906930|ref|YP_321226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]