SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q91X91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q91X91
Domain Number 1 Region: 114-285
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.84e-52
Family NadC C-terminal domain-like 0.0000236
Further Details:      
 
Domain Number 2 Region: 9-113
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.92e-25
Family NadC N-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q91X91
Sequence length 299
Comment (sp|Q91X91|NADC_MOUSE) Quinolinate phosphoribosyltransferase [decarboxylating] KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Qprt; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MDPEGLQLLLPPTTLAALANSWLQEDCPGLNFASLVTGSAPSQAVLWAKSPGVLAGRPFF
DAIFTQLNCQVSWFLPEGSKLVPVVKVAEVKGPAHHLLLGERVALNTLARCSGIASAAAT
AVEVARSTGWTGHVAGTRKTTPGFRLVEKYGLQVGGAACHRYDLGGMVMVKDNHVVAAGS
MERAVLKARQAAGFSLKVEVECSSLEEAFRAAEAGADLVMLDNFKPEELHPTAATLKARF
PSVSVEASGGVTLDNLTQFCGTHIDVISLGMLTQAAPALDFSLKLFAEGDTPVPHARRF
Download sequence
Identical sequences Q91X91
NP_598447.1.92730 ENSMUSP00000032912 399922 ENSMUSP00000032912 ENSMUSP00000032912 10090.ENSMUSP00000032912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]