SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q92DC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q92DC6
Domain Number 1 Region: 154-248
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000412
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q92DC6
Sequence length 278
Comment (tr|Q92DC6|Q92DC6_LISIN) RsbR protein {ECO:0000313|EMBL:CAC96120.1} KW=Complete proteome OX=272626 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262). GN=RsbR OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MYKDFANFIRTNKKDLLNNWMNEMEKQSDPLINDIAKEPMYEETSIEFVDLIVSNITENG
SKFNEKLDDFAEKVVHLGWPIHFVTTGLRVFGLLVYTAMRDEDLFLKREEKPEDDAYYRF
ETWLSSMYNKVVTAYADTWEKTVSIQKSALQELSAPLLPIFEKISVMPLIGTIDTERAKL
IIENLLIGVVKNRSEVVLIDITGVPVVDTMVAHHIIQASEAVRLVGCQAMLVGIRPEIAQ
TIVNLGIELDQIITTNTMKKGMERALALTNREIVEKEG
Download sequence
Identical sequences H1GC23 Q92DC6
APC63293 WP_003771126.1.41348 WP_003771126.1.46653 WP_003771126.1.51650 WP_003771126.1.67429 WP_003771126.1.70104 WP_003771126.1.83607 WP_003771126.1.99521 WP_003771126.1.99921 272626.lin0888 gi|16799961|ref|NP_470229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]