SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q938M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q938M0
Domain Number - Region: 9-38
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0144
Family NfeD domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q938M0
Sequence length 56
Comment (tr|Q938M0|Q938M0_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AAL15062.1} KW=Complete proteome; Reference proteome OX=173707 OS=Temperate phage phiNIH1.1. GN= OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Siphoviridae.
Sequence
MRKYIEFKDEWKSAADHLNDFIDKNKYAKVTGDLWQGSDQVIAEQCFLKVLEEMQK
Download sequence
Identical sequences A0A0H2UVG2 Q1CPB3 Q1CQ27 Q48SE0 Q938M0
gi|71903922|ref|YP_280725.1| gi|94994250|ref|YP_602348.1| gi|21910778|ref|NP_665046.1| Q938M0_9CAUD NP_438133.1.24609 gi|28895534|ref|NP_801884.1| gi|94990327|ref|YP_598427.1| gi|94990845|ref|YP_598945.1| 193567.SPs0622 198466.SpyM3_1242 319701.M28_Spy1260 370552.MGAS10270_Spy0818 370552.MGAS10270_Spy1336 370554.MGAS10750_Spy0854 gi|16271796|ref|NP_438133.1| gi|28876356|ref|NP_795565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]