SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q94655 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q94655
Domain Number 1 Region: 3-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.51e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000755
Further Details:      
 
Domain Number 2 Region: 381-495
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.52e-47
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q94655
Sequence length 500
Comment (sp|Q94655|GSHR_PLAFK) Glutathione reductase OX=5839 OS=Plasmodium falciparum (isolate K1 / Thailand). GN=GR2; OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVYDLIVIGGGSGGMAAARRAARHNAKVALVEKSRLGGTCVNVGCVPKKIMFNAASVHDI
LENSRHYGFDTKFSFNLPLLVERRDKYIQRLNNIYRQNLSKDKVDLYEGTASFLSENRIL
IKGTKDNNNKDNGPLNEEILEGRNILIAVGNKPVFPPVKGIENTISSDEFFNIKESKKIG
IVGSGYIAVELINVIKRLGIDSYIFARGNRILRKFDESVINVLENDMKKNNINIVTFADV
VEIKKVSDKNLSIHLSDGRIYEHFDHVIYCVGRSPDTENLKLEKLNVETNNNYIVVDENQ
RTSVNNIYAVGDCCMVKKSKEIEDLNLLKLYNEERYLNKKENVTEDIFYNVQLTPVAINA
GRLLADRLFLKKTRKTNYKLIPTVIFSHPPIGTIGLSEEAAIQIYGKENVKIYESKFTNL
FFSVYDIEPELKEKTYLKLVCVGKDELIKGLHIIGLNADEIVQGFAVALKMNATKKDFDE
TIPIHPTAAEEFLTLQPWMK
Download sequence
Identical sequences Q94655
1onf_A 1onfA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]