SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q96DR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96DR7
Domain Number 1 Region: 422-641
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-57
Family DBL homology domain (DH-domain) 0.0000516
Further Details:      
 
Domain Number 2 Region: 631-780
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-20
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 3 Region: 785-851
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q96DR7
Sequence length 871
Comment (sp|Q96DR7|ARHGQ_HUMAN) SH3 domain-containing guanine exchange factor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARHGEF26; OC=Catarrhini; Hominidae; Homo.
Sequence
MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITDFPVEDGGTLL
AAQIPAQVPTASDSRTVHRSPLLLGAQRRAVANGGTASPEYRAASPRLRRPKSPKLPKAV
PGGSPKSPANGAVTLPAPPPPPVLRPPRTPNAPAPCTPEEDLTGLTASPVPSPTANGLAA
NNDSPGSGSQSGRKAKDPERGLFPGPQKSSSEQKLPLQRLPSQENELLENPSVVLSTNSP
AALKVGKQQIIPKSLASEIKISKSNNQNVEPHKRLLKVRSMVEGLGGPLGHAGEESEVDN
DVDSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKVVMEDKEKFSSLGRI
KKKMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQ
LSAVKRKGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDTMTKTER
HHLFSNITDVCEASKKFFIELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQ
RTLQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDS
PKYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRG
ELTAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDNE
ELNSSPGKNSSTMLYSRQSSASHLFTLTVLSNHANEKVEMLLGAETQSERARWITALGHS
SGKPPADRTSLTQVEIVRSFTAKQPDELSLQVADVVLIYQRVSDGWYEGERLRDGERGWF
PMECAKEITCQATIDKNVERMGRLLGLETNV
Download sequence
Identical sequences A0A140VJU4 Q96DR7
9606.ENSP00000348828 gi|194473700|ref|NP_056410.3| NP_001238891.1.87134 NP_001238891.1.92137 NP_056410.3.87134 NP_056410.3.92137 ENSP00000348828 ENSP00000423418 ENSP00000348828 ENSP00000348828 ENSP00000423418 ENSP00000481927 ENSP00000484367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]