SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q96QV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q96QV6
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Histone-fold 5.24e-48
Family Nucleosome core histones 0.00000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q96QV6
Sequence length 131
Comment (sp|Q96QV6|H2A1A_HUMAN) Histone H2A/r KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HIST1H2AA; OC=Catarrhini; Hominidae; Homo.
Sequence
MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLT
AEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TESHHHKAQSK
Download sequence
Identical sequences H2QSE5 Q96QV6
NP_734466.1.87134 NP_734466.1.92137 XP_003823260.1.60992 XP_518282.1.37143 ENSPTRP00000030373 ENSP00000297012 ENSP00000297012 ENSPTRP00000030373 ENSP00000297012 gi|25092737|ref|NP_734466.1| 9598.ENSPTRP00000030373 9606.ENSP00000297012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]