SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q970I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q970I6
Domain Number 1 Region: 176-269
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000000418
Family Multidrug resistance efflux transporter EmrE 0.033
Further Details:      
 
Domain Number 2 Region: 55-134
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000484
Family Multidrug resistance efflux transporter EmrE 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q970I6
Sequence length 270
Comment (tr|Q970I6|Q970I6_SULTO) Putative DMT family transporter {ECO:0000313|EMBL:BAB66687.1} KW=Complete proteome; Reference proteome OX=273063 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7). GN=STK_16090 OC=Sulfolobus.
Sequence
MIKRGILDLVTASALWGTIGIVTQIGYEHNANVFQIILFRSLSSSLLVFMVFRNVKTILD
RISLIMGVVAVIFYETYVYSVNILGASLSAVFLYTAPLWVILASKVYLKDEINNRKILAS
ILVVIGVYLIYFSKISIVSIGWGIASGFTYALLIIYSRFMQIKGYKDQEILASQAFWSLP
FSLLFLILSPDLTGSSILTGIYLGIVATFLAYIFFYRGMRLTDSITASIISSLEPVFTII
FAIIILHQILTPLQFLGSGIIIFSSILISL
Download sequence
Identical sequences Q970I6
273063.ST1609 gi|15921909|ref|NP_377578.1| WP_010979665.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]