SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q971N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q971N1
Domain Number 1 Region: 73-152
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000000279
Family Polyphosphate kinase C-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q971N1
Sequence length 348
Comment (tr|Q971N1|Q971N1_SULTO) Uncharacterized protein {ECO:0000313|EMBL:BAB66389.1} KW=Complete proteome; Reference proteome OX=273063 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7). GN=STK_13300 OC=Sulfolobus.
Sequence
MLFIKFYYFIMIKTVMKPCINLLECIDSGVRAVKIAVAYVKRSGVNRFSEFLQNTKECLI
ITSLDFGITELEGLKELKRLGCNVYLYNGGNEFHPKVYILDYGYKKIAVIGSSNLSEGAI
TGKNIEFNLIVEEDEIVREAEVLINKLLSESDPVTDDLISQLEKNGYEKIRRAVYDKPGK
VILSILRNRQRYCEEFVKLYNEIRQHKERGKMAGLRKKSHEMGINKVACDLISKGIDVGD
EVGSDITVYAGKSKIRIKVQGMVLPNNPARVYDLDFDYFIIVVVTDLNSADYFIIERNEV
ERLIKEGLIKYKKGSEKYGWIPRKVYEKYKIDLDDLVNKLREAKLSRA
Download sequence
Identical sequences Q971N1
273063.ST1330 gi|15921611|ref|NP_377280.1| WP_010979367.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]