SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q972J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q972J2
Domain Number 1 Region: 49-131
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000941
Family Cgl2762-like 0.038
Further Details:      
 
Weak hits

Sequence:  Q972J2
Domain Number - Region: 8-46
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0179
Family Transcriptional factor domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q972J2
Sequence length 244
Comment (tr|Q972J2|Q972J2_SULTO) Putative transposase {ECO:0000313|EMBL:BAB66174.1} KW=Complete proteome; Reference proteome OX=273063 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7). GN=STK_11390 OC=Sulfolobus.
Sequence
MGRKPVIRHDIACPSCGSHHVVKCGKPLGRQRFLCRDCGKYFLADAVYHHHSKEVREEAL
RMYTNGMSMRAISRVLNVPLGTVFTWVKRYGKRKYEKLVDLWNKAKELVKGKVVTKVVDE
MWTYLYRNTRAFYKWVFTCHVYTRLGLYIIYSVGDRDENTFSEVKMYLPDDGRWVSDDYN
VYFWLKDHTVVSPVNPNESFHSSLRDRLVRFKRATKAVNRSINMVKYSIALVLWERRLIP
EFVA
Download sequence
Identical sequences Q972J2
gi|15921396|ref|NP_377065.1| 273063.ST1139 WP_010979155.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]