SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q972X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q972X0
Domain Number 1 Region: 11-195
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.44e-27
Family FAD-linked oxidases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q972X0
Sequence length 372
Comment (tr|Q972X0|Q972X0_SULTO) Uncharacterized protein {ECO:0000313|EMBL:BAB66043.1} KW=Complete proteome; Reference proteome OX=273063 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7). GN=STK_10190 OC=Sulfolobus.
Sequence
MDFLSKYFKEVITSIDILEKYSTDYSYISPIISSMKKIPKAVIKIKSEEDIKKVIELMNE
YHFPVIVRGKGTNTLGATIPIKENTVILDITGLKGFEKSKGCLLAYTGTEFNEPGINDLP
VIPTSFYMATVGGFVEGGSLGFGSLKNGAVWDNVIEAEVYTLKGKYTLTGNEVYSIVQSA
GTTGILTRIKFRLVKNRKGIEIEKQKFNSLSEAINFSLKVIDYAEFISIRNYPMAKEIEP
GENWSKWNVIYGIESDKGFQLKDIITTFAGAYFTVVNKTGLYYNSLDISLDELEKIDTQD
CYVSAELSKSSIKYFSHTYFIGCNKLPNVGKMFNLHSYKINDRVEERRLKYIINFKRKVD
PEDLFNSGKLDF
Download sequence
Identical sequences Q972X0
273063.ST1019 gi|15921265|ref|NP_376934.1| WP_010979025.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]