SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q97AF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q97AF0
Domain Number 1 Region: 230-495
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.88e-59
Family PFOR Pyr module 0.035
Further Details:      
 
Domain Number 2 Region: 507-618
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.71e-21
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.038
Further Details:      
 
Domain Number 3 Region: 1-251
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.41e-20
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q97AF0
Sequence length 629
Comment (tr|Q97AF0|Q97AF0_THEVO) 2-ketovalerate ferredoxin oxidoreductase [VOR] alpha subunit {ECO:0000313|EMBL:BAB60002.1} KW=Complete proteome OX=273116 OS=15438 / GSS1). GN=TVG0881751 OC=Thermoplasmataceae; Thermoplasma.
Sequence
MDFNILIGGPQGGGIDTAANLVGKAVATSGYGVLSVREYHSNIKGRHSYTHMRVKEDQPR
SLKYPVNIFVALDPDTIFEHLDDVSEASIVIYDKTTEDYDLQAARMIMRDTSAKIRSILQ
ENGFETTIRGALKYMQKRGAKLLPVPFADIATQAVPNGTPSRYFNTIGAAIALAIIGIDE
KFAKDSISYIFRGKQQVVEENVKVVEQSYKFATDSGVAGKTLPAKPTPRKLLLTGNDASA
LGKLLGGLRFQTYYPITPASDESTTLEEHQNIKWLKNEAESLKKGGVVIVQTEDELSAIN
MAIGGALTGARSATATSGPGFSLMAEGLSFAGMDEVPLVVTFYERGGPSTGLPTRNGQSD
LLFALNAGHGEYPRIVFSSGTVDECIYDAVKALNYAAKYQMPVIHLIDKNLANTLDLISK
IDLDKVKIEKVELAKEGDDVKRYDLNTQNGVSPYAVMGRNIFWMTGDEHDELGHVTEDSD
IRDRMMEKRFKKLETADKEIPVDEKAQLIGPEDADITFVTWGSQKGPILDVIEDLKQDDI
TANLLYLKMFSPFPTEFVKSILSKAHLVIDVESNFTAQAAQMIKLYTGIEIENKILKYNG
RHMTEDEILNSAKNILNKKSLMVVLEDGS
Download sequence
Identical sequences Q97AF0
273116.TVN0846 gi|13541677|ref|NP_111365.1| WP_010917104.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]