SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q97AF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q97AF3
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Transposase IS200-like 1.31e-45
Family Transposase IS200-like 0.000000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q97AF3
Sequence length 134
Comment (tr|Q97AF3|Q97AF3_THEVO) Transposase {ECO:0000313|EMBL:BAB59999.1} KW=Complete proteome OX=273116 OS=15438 / GSS1). GN=TVG0878378 OC=Thermoplasmataceae; Thermoplasma.
Sequence
MELKSTRHVKYLCNYHYLWIPKYRRAILTNEVAEYTKEVLKSIAKELGCEIIALEVMPDH
IHLFVNCPPRYSPSYLTNYFKGKSARLILKKSPELRRYKKLWSRSYFVSTAGNVSSETIK
KYIEEQWVKEGEEG
Download sequence
Identical sequences Q97AF3
WP_010917101.1.10044 gi|13541674|ref|NP_111362.1| 273116.TVN0843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]