SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q97BG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q97BG0
Domain Number 1 Region: 10-342
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.04e-49
Family AAT-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q97BG0
Sequence length 345
Comment (tr|Q97BG0|Q97BG0_THEVO) Aspartate aminotransferase {ECO:0000313|EMBL:BAB59638.1} KW=Complete proteome OX=273116 OS=15438 / GSS1). GN=TVG0480705 OC=Thermoplasmataceae; Thermoplasma.
Sequence
MQWLTFQWLEFIREYREKAKHNLSNSGMPEPDLKSLGIDTSYEHYLDAAGEVEYRFTEAL
SRRLRVDQDLIIPTVGGTEAIFIALSHLSSVSKRIHVPLPEYEPMFLVPESLGIETSKIE
SKVMPGRISKNESIAMTLPNNPTAQYSDRISLLDNVIHSEGLIYIDETFRDFLPSGTRPT
LFDGSETMVVSGTMTKFYGLSNLRTGWIISSEHNVAGMRRIKDLTSINNASFSLYIAAQA
IQKWNYFKEAEDNLINKNLRVAREYLEGLPGISYKEPEGAPFIFLSYSKNIESVKLAKLA
VERYGILFAPGSFFGEEHHIRVCLTSNKPEEDFNVLKEFLKKEAV
Download sequence
Identical sequences Q97BG0
gi|13541327|ref|NP_111015.1| WP_010916754.1.10044 273116.TVN0496 375716 APC88399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]