SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q97BQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q97BQ1
Domain Number 1 Region: 2-396
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.79e-111
Family AAT-like 0.0000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q97BQ1
Sequence length 402
Comment (tr|Q97BQ1|Q97BQ1_THEVO) Aspartate aminotransferase {ECO:0000313|EMBL:BAB59546.1} KW=Complete proteome OX=273116 OS=15438 / GSS1). GN=TVG0393535 OC=Thermoplasmataceae; Thermoplasma.
Sequence
MNYKFSEIFRYIKPSEIRSLLKYTSDPELISFGGGMPNPESFPVEEMKEILADIMDNYGK
KALQYGTTEGLDVLRDELAKYVLKTEGINAKREEIILTTGSQQALYAIAKIFVNPNDPVI
TEGPTYVGAISAFNANTANMMAIDIDENGMNVDELEAKIKELSQNGLKPKFIYVIPTFQN
PAGTTMSLDRRKRLLEISERYEIPIVEDNPYGQLRYDGEPVQSIKSMDKNGNVIYLGTFS
KVMAPGLRLGYVIAPREVIDKINLLKQGLDLASDSLSEYIAYEYLKRGAIYRQIPKTVDL
YRKKRDLMIKSLEEYFPEAATWTKPHGGMFLWVSLDERIDTTKMLDRALKAKVAYVSGSA
FYPHGEKHNSMRLNFTYSDDDKIVEGIKRLAYVINEEMEVVE
Download sequence
Identical sequences Q97BQ1
gi|13541233|ref|NP_110921.1| 273116.TVN0402 WP_010916660.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]