SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q97BY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q97BY2
Domain Number 1 Region: 5-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000986
Family GHMP Kinase, N-terminal domain 0.0075
Further Details:      
 
Domain Number 2 Region: 194-303
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000288
Family Mevalonate 5-diphosphate decarboxylase 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q97BY2
Sequence length 320
Comment (tr|Q97BY2|Q97BY2_THEVO) TVG0327166 protein {ECO:0000313|EMBL:BAB59465.1} KW=Complete proteome OX=273116 OS=15438 / GSS1). GN=TVG0327166 OC=Thermoplasmataceae; Thermoplasma.
Sequence
MSNSSITSVAYPTIGVVLLGGIANEKTRTPLHTSAGIAYTDSCGSIRTESTIYGDSEMHI
YFNGTESKDENRSVKSVLERYRNELQSFFGKKDVSYSSLNYGILSGSSDAGAASIGAILS
FIDKKNDIHDIENDIRMISESAGRSLHGGLTITWSDGYSAYTERVLGPEHFNNYAIVGFS
FDYPRNPSDTIHQNIIKSKRYKQRTIDADEHAHEIKEMARTDDIEGIFEKAEEDTEEYHS
ILREVGVLVIRENMQKLIEFIKILRKEFWNSYIVTGGSNVYVIVRRDDLERLIHIKNTFG
SKPKILNVAGPAWIKKVESD
Download sequence
Identical sequences Q97BY2
gi|13541151|ref|NP_110839.1| 273116.TVN0320 WP_010916578.1.10044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]