SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q97YE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q97YE2
Domain Number 1 Region: 13-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000296
Family Middle operon regulator, Mor 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q97YE2
Sequence length 152
Comment (tr|Q97YE2|Q97YE2_SULSO) First ORF in transposon ISC1078 {ECO:0000313|EMBL:AAK41618.1} KW=Complete proteome; Reference proteome OX=273057 OS=P2). GN=SSO1384 OC=Sulfolobus.
Sequence
MPKSRMHGIRLDKKQEEERRINAVKDVRNGMSIKDVAKKYDVSIFTVYKWLRKGDLSAKP
RKGPTKLKDEEKLVRILEKSPRDFGLNYDFWTLKLIAYILDKEFGIKYNPRSLSPVLKKL
GFKYKKGKRTYVRDDNAVERWVKEQGEKLLKK
Download sequence
Identical sequences A0A157T0X0 Q97YE2
WP_010923367.1.8449 gi|15898223|ref|NP_342828.1| 273057.SSO1384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]