SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q988K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q988K6
Domain Number 1 Region: 41-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000216
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q988K6
Sequence length 118
Comment (tr|Q988K6|Q988K6_RHILO) Mll6698 protein {ECO:0000313|EMBL:BAB52941.1} KW=Complete proteome; Reference proteome OX=266835 OS=Rhizobium loti (strain MAFF303099) (Mesorhizobium loti). GN=mll6698 OC=Phyllobacteriaceae; Mesorhizobium.
Sequence
MRRSQAMEIKTDDYRVWIEGSDIFFDGVMRLASSEAGAPIMALATSALASNPSSMTLNLK
DLHFLNSSGINLLAKFTIEVRKHPDVRFVVRGTPDIPWQSKSLPNLKKLHPALVLLMD
Download sequence
Identical sequences Q988K6
392906 266835.mll6698 gi|13475591|ref|NP_107155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]