SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q99KC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q99KC8
Domain Number 1 Region: 282-449
Classification Level Classification E-value
Superfamily vWA-like 2.09e-25
Family RoRNP C-terminal domain-like 0.042
Further Details:      
 
Weak hits

Sequence:  Q99KC8
Domain Number - Region: 673-766
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00251
Family Terpene synthases 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q99KC8
Sequence length 793
Comment (sp|Q99KC8|VMA5A_MOUSE) Loss of heterozygosity 11 chromosomal region 2 gene A protein homolog KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Vwa5a; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEHHCGLITSNKETVPLKNISVTLSINEFVAAVVATLNYENEEKVPLEATFVFPMDEDSA
VYSFEALVDGKKIVAELQDKMKAHSEYEEALSQGHQAYLLEEDDYSRDVFSCNVGNLQPG
AKVAVTLRYVQELPLETDGALRYLLPAILNPRYQLSEQSANSCLNIQKPTVPLEDLPYTL
NMTATITSQHGIERVQSNCSLSPIQYLTDDKTSAQVSLTEGHKFDRDVELLIYYNEVHSP
SVAVEMGMLDMKPDSLMGAPSAMVSFYPDIPEVEASKACGEFVFLMDRSGSMDSPMSTEN
NSQLRIEAAKETLLLLLKSLPMGCYFNIYGFGSSYEKFFPESVKYTQDTMEDAVKRVKAL
KANLGGTEILTPLCNIYKASSIPGHPLQLFVFTDGEVSDTFSVIREVKLNSKKHRCFSFG
IGQGASTSLIKNIARVSGGTAVFITGKDRMQTKALGSLKFALQCAVDNISLSWDLPPGLS
VKMLSPEQLTIFRGQRLIIYAQLTGLMPQVESTGAVCLKHILQGRSLENRVTFSLQPKAN
DNFTIHRLAAKSLIQTKDFGSQEASKEEKEDVMNISLQSGVLSSFTAFIAINKELNKPVQ
GPLAHRVIPRPVMAGSSSMRFYSSFSGGFKGPQPRSLRVPAYDLCSAESANLVLKKSACS
AIQKKKTNSSTNKSNLKKEHKAFGENAVVQLISLQKANGSWELDEDLTKILGTKSKDIKA
ANPAKHEDPSAWSTVLAVVWLHANGTDLKCEWELLERKAVAWLHDHAGSSIPMLVQAANS
LLKLSVNPAVFGV
Download sequence
Identical sequences Q99KC8
ENSMUSP00000001544 10090.ENSMUSP00000113596 NP_001139429.1.92730 NP_766355.3.92730 ENSMUSP00000001544 ENSMUSP00000001544 ENSMUSP00000113596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]