SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q99PM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q99PM3
Domain Number 1 Region: 321-378
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.39e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 7-51
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000288
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q99PM3
Sequence length 378
Comment (sp|Q99PM3|TF2AA_MOUSE) TFIIA p19 subunit KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Gtf2a1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH
SEEQQLLLQVQQQHQPQQQQHHHHHHQHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVI
VPDSKLLQHMNASSITSAAATAATLALPAGVTPVQQLLTNSGQLLQVVRAANGAQYILQP
QQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPT
TVAAPAPAQAPMPAAGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEED
KEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIM
NLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences Q99PM3
10090.ENSMUSP00000021345 ENSMUSP00000021345 NP_113568.2.92730 ENSMUSP00000021345 ENSMUSP00000021345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]