SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9C9W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9C9W7
Domain Number 1 Region: 225-274
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000175
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9C9W7
Sequence length 314
Comment (tr|Q9C9W7|Q9C9W7_ARATH) Uncharacterized protein T23K23.12 {ECO:0000313|EMBL:AAG52000.1} OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At1g68030 OC=Arabidopsis.
Sequence
MEPPNSNSVCDRFVTGNLDLDNWIWIIEYFAKFKTELWMLNDVFELAPKLPDYLGEYTNE
MVAFRCLASLFDSHVVSVTTTTTTTSMIEFDSSESCEYVLQCILDEIPLSELKPGAPGLT
KWNLQPFIKHKLLSLPKCALELMIEPSSCENDTQVSPCSEEETLRSDGKENDRVTPPMDE
PDLTGRTEEGESFSRGADELLDRRNAGFRYESENDGSHLSSPVEKIYRCVNCKESGKLLF
CSSDGCEVMVHQKCLDSPPSYHDAGDFYCSLCALTCPSAEYVQFQDEVAKAKRKLVSFLR
LMSEVNKKKSIEGT
Download sequence
Identical sequences A0A178WIA4 Q9C9W7
3702.AT1G68030.1-P AT1G68030.1 AT1G68030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]