SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9CG29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9CG29
Domain Number 1 Region: 3-197
Classification Level Classification E-value
Superfamily ITPase-like 1.54e-62
Family ITPase (Ham1) 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9CG29
Sequence length 201
Comment (sp|Q9CG29|IXTPA_LACLA) Nucleoside-triphosphate pyrophosphatase {ECO:0000255|HAMAP-Rule:MF_01405} KW=Complete proteome; Reference proteome OX=272623 OS=lactis). GN=ynbD; OC=Lactococcus.
Sequence
MEKTLIIATRNSGKTKEFKKLFADFGYEIKDLTDYPELSEIEETGTTFEENARLKAEQIA
EITGQVVIGDDSGLCVDVLGGLPGIWSHRFSAPDPTDEKNIAKLLHELAPTAITPERRSA
HFHTTLVAAKPGRESLVVEADWDGYIALAPKGENGFGYDPIFMVDAFRTAAELSEKEKNQ
VSHRGQALRKLMAELPEWLYK
Download sequence
Identical sequences Q9CG29
gi|15673263|ref|NP_267437.1| 272623.L111484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]