SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9CNK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9CNK8
Domain Number 1 Region: 92-296
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.33e-35
Family Phosphate binding protein-like 0.0041
Further Details:      
 
Domain Number 2 Region: 4-116
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.44e-23
Family LysR-like transcriptional regulators 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9CNK8
Sequence length 308
Comment (tr|Q9CNK8|Q9CNK8_PASMU) MetR {ECO:0000313|EMBL:AAK02505.1} KW=Complete proteome; Reference proteome OX=272843 OS=Pasteurella multocida (strain Pm70). GN=PM0421 OC=Pasteurellaceae; Pasteurella.
Sequence
MKPIFLELRHLKTLLALKETGSVSLAAKRVYLTQSALSHQLKLLEEQYGLPLFERKTQPL
HFTPAGERLIQLANEILPKVVEAERDLARVKQGEAGELRIAVECHTCFDWLMPAMDSLRQ
NWPLVELDIVSGFHTDPVGLLLTHRADWAVVSEIEETAGIIHKPLFSYEMVGLCAKDHPL
ATKEIWEPEDFIDQTLITYPVPDDMLDLLRKVLHPNGINPLRRTSELTIAIIQLVASKRG
IAALPFWAAKPYLDRGYLVARKITKQGLYSNLYAAIREIDANVAFVDDFYETVKAQSFST
LPALSVLE
Download sequence
Identical sequences Q9CNK8
272843.PM0421 WP_005726139.1.12311 WP_005726139.1.15732 WP_005726139.1.19996 WP_005726139.1.26777 WP_005726139.1.40210 WP_005726139.1.41351 WP_005726139.1.41667 WP_005726139.1.45422 WP_005726139.1.4808 WP_005726139.1.53852 WP_005726139.1.55074 WP_005726139.1.58111 WP_005726139.1.6219 WP_005726139.1.62389 WP_005726139.1.66990 WP_005726139.1.70689 WP_005726139.1.81885 WP_005726139.1.8281 WP_005726139.1.88402 WP_005726139.1.89773 WP_005726139.1.92478 WP_005726139.1.93940 WP_005726139.1.9746 WP_005726139.1.9947 gi|15602286|ref|NP_245358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]