SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9FFX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9FFX2
Domain Number 1 Region: 236-362
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000161
Family B3 DNA binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9FFX2
Sequence length 364
Comment (sp|Q9FFX2|Y5849_ARATH) B3 domain-containing protein At5g38490 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At5g38490; OC=Arabidopsis.
Sequence
MSSIMYHDNHLTDSGKNMSSGLSLLAYVTVMVAEEEEQRSRLLAEKREESKCKMSFFYLF
PRKIKSSLAKRRYTQQNPNGASTCSSSLPDLNLIPTDFETDNLQNPCFDEPMVCDEEQRL
KKGKSKIVYDEDYDDESEKKLFDNLNGASTSSSSLLNLPCLEPSTETKDVPNPNYQSSSP
SSCLTGKTNRKRRAVEQRKSGKVKKVKVSPLPRLCTEMPEWIFQVMRYMNADAETPRLIF
ERTLFKSDVNSNLSRLLMPFQKLIRNDFLTPAECRAMQKDEDNDEEDDENIGVGTVLVNQ
RFQKWGLRFKIWAMEKDSGHGTLNYTLNWGWNDVVKSSSLKVGDKISLWTFRCRGVLCFA
LDTE
Download sequence
Identical sequences Q9FFX2
AT5G38490.1 3702.AT5G38490.1-P AT5G38490.1 NP_198665.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]