SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9FHB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9FHB0
Domain Number 1 Region: 14-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.59e-18
Family B3 DNA binding domain 0.00044
Further Details:      
 
Domain Number 2 Region: 229-322
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000216
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9FHB0
Sequence length 328
Comment (sp|Q9FHB0|Y5014_ARATH) B3 domain-containing protein At5g60140 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At5g60140; OC=Arabidopsis.
Sequence
MNTRGNYSNGFTSKFFKPYLPSESGDDLVLPISFNSCLPKSLPKTVTVRSISGNIWKLGF
KKCGGEVERFVMVSGWKKIVRDENLNGGDLLSFEFDGSHFFNFSIFDHETTCKRLKRSSE
QSKDIIKVGSDCEEESQASDDVIVLNSDDSDDSDNDYSVEDDNVAEDDDGLEDEVDVEAE
DGYDAKDSDGLEDEDDDEAEDGYDAKDDDGLEDEDDLEDEDDERRYLDDHENPYFTMTLN
PKKKSQLHIPAHVIRDYDLTFPERITVVDEMGALEKAIKIQKNGCIFVKGFGSFIRRNKM
KMTDKMICELKRTGGNLVHTIKVKIISG
Download sequence
Identical sequences Q9FHB0
3702.AT5G60140.1-P AT5G60140.1 AT5G60140.1 NP_200822.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]