SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9HAE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9HAE3
Domain Number 1 Region: 15-197
Classification Level Classification E-value
Superfamily EF-hand 1.33e-34
Family Calmodulin-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9HAE3
Sequence length 211
Comment (sp|Q9HAE3|EFCB1_HUMAN) EF-hand calcium-binding domain-containing protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=EFCAB1; OC=Catarrhini; Hominidae; Homo.
Sequence
MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVT
FGMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFI
SKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLL
LEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM
Download sequence
Identical sequences A0A024R7U5 Q9HAE3
9606.ENSP00000262103 ENSP00000400873 ENSP00000262103 gi|13375787|ref|NP_078869.1| GO.42788 ENSP00000262103 NP_078869.1.87134 NP_078869.1.92137 XP_005251360.1.92137 XP_011515891.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]