SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9HKY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9HKY2
Domain Number 1 Region: 59-223
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.12e-16
Family GHMP Kinase, N-terminal domain 0.0061
Further Details:      
 
Domain Number 2 Region: 244-344
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000000000000135
Family Mevalonate 5-diphosphate decarboxylase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9HKY2
Sequence length 384
Comment (tr|Q9HKY2|Q9HKY2_THEAC) Uncharacterized protein {ECO:0000313|EMBL:CAC11603.1} KW=Complete proteome; Reference proteome OX=273075 OS=NBRC 15155 / AMRC-C165). GN=Ta0461 OC=Thermoplasmataceae; Thermoplasma.
Sequence
MAPHLMASGKSWHDSIYTYNQYYHVQPFDMEKLLRDRGIYRRPGMHAIRPAYRKIAFGAG
YSEIGIIKSLGYYDSTFNILNFPCVSMAADFSRAYAALVLTENIGEDTFILNGRQDEQTM
IMARRVVQLLRSIYSIRGSFHVYIKVDNKQGGGCGHWESAAVAAAFARSVARSVFDESAI
EDGPFLSKMARLVSGSGAASTTGPLSVLISWPGYAHDTSFALGLPMPDTGIALCAVPIAA
DFHRSNIHEVALRSPFYREWATYTRHALLDLLNSEFDADTIIRTATNSSLMMHATLMSSR
SILWTEKTIDVVSRILEMRSGGRAVGFSIDAGPSVVLMARNAAELDEARRSIDAECVDGS
ITSGEPSIPPEFLRMAREALDRYT
Download sequence
Identical sequences Q9HKY2
273075.Ta0461 gi|16081580|ref|NP_393939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]