SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9I7H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9I7H5
Domain Number 1 Region: 173-259
Classification Level Classification E-value
Superfamily TPR-like 0.000000317
Family Tetratricopeptide repeat (TPR) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9I7H5
Sequence length 527
Comment (tr|Q9I7H5|Q9I7H5_DROME) Prolyl-4-hydroxylase-alpha SG2 {ECO:0000313|EMBL:AAG22175.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG1546 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLDRHCLYIGIFQLIIWVGVANGEFYSSVDSMQDLAQVEEELLNATRSYVESQQKQLDFY
RRYVEQIKREHEWATSQLKLDDYLGHPLHAFRLIKRLVRDWDSLIFEPILANNAREEFRA
FVEVLSRDLGYPDQSELQGAIKGLARLQKVYNLATSDLADGIIGGLNYGSDLRWRECYEI
GVQLFDLGEYQRSLEWLQVAFILLRNSPREEKDADHYLSDIREYASMANFELGNPKKAAR
LLSQILESQPTHSAQQTQKYLESRVPGKNVQETKPSWFSNYTRLCQGRRLPEERSGDPLR
CYLDGKRHAYFTLAPLQVEPVHLDPDINVYHGMLSSKQILSIFEEADKEEMVRSAVAGSG
GEGTVRDLRVSQQTWLDYKSPVMNSVGRIIQFVSGFDMAGAEHMQVANYGVGGQYEPHPD
YFEVNLPKNFEGDRISTSMFYLSDVEQGGYTVFTKLNVFLPPVKGALVMWHNLHRSLHVD
ARTLHAGCPVIVGSKRIGNIWMHSGYQEFRRPCNLTSDSYKSLAYRD
Download sequence
Identical sequences Q9I7H5
FBpp0085015 NP_651801.1.81976 FBpp0085016 FBpp0085015 7227.FBpp0085015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]