SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9K7M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9K7M1
Domain Number 1 Region: 16-136
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-25
Family Voltage-gated potassium channels 0.00066
Further Details:      
 
Domain Number 2 Region: 116-251
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.97e-19
Family Potassium channel NAD-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  Q9K7M1
Domain Number - Region: 258-335
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0628
Family TrkA C-terminal domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9K7M1
Sequence length 338
Comment (tr|Q9K7M1|Q9K7M1_BACHD) Potassium channel protein {ECO:0000313|EMBL:BAB07059.1} KW=Complete proteome; Reference proteome OX=272558 OS=9153 / C-125). GN=BH3340 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MVNPLAIKGIVGKTPLLVRLLFIIFVIVFVIGIVIHALEPEAFPTLFDGIWWAIVTISTV
GYGDFVPYTLIGRLLGIVLIMSGVGFMTFYVTTLAATTIKSRNAYLEGKLHMTDKDHHII
IGWNERSRHAIDRLLEANENTTIVLIDETLEELPSTYRRVHFVRGNSTEDAILQQANVRE
AASVLITAKHQGSEFSADSRSILTTLAVKSINPHVYTVVEILTEGQIVNATRAGADEVVE
STALTGAVLTNGLLHHNMSKILDRLLTEGEKKQLFFYPIPEGMIGKTFDDYFQSLYESDE
GLAIGLKRVDRIHLYPPKNMLLLSGDEVALLVRTESHL
Download sequence
Identical sequences A0A0M0KHT7 Q9K7M1
1797M APC64605 gi|15615902|ref|NP_244206.1| WP_010899481.1.28103 WP_010899481.1.91347 272558.BH3340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]