SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9KCC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9KCC1
Domain Number 1 Region: 3-268
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.24e-72
Family Phosphate binding protein-like 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9KCC1
Sequence length 287
Comment (tr|Q9KCC1|Q9KCC1_BACHD) Menaquinone biosynthetic enzyme MqnA {ECO:0000256|HAMAP-Rule:MF_00995} KW=Complete proteome; Reference proteome OX=272558 OS=9153 / C-125). GN=BH1652 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MTITVGEIKYTNAFPFFYYVDRNKLLEKDCHFLIQTPATLNREMKAGRIQVGPISSFAYA
ENVDEFVLMPNLSVSANGPVGSIFLYTKRPLEELEGSRIALTTTSATSVHLLKILLKQYV
GVNVTYDEMDPSFDEMMQDHDGCLLIGDEAIVTSWREEVETYRYDLGELWKEYTGTSMTF
AVFAVRKDAIARQRAILEELYTAFVLSKEKNRKEQYASMIGHIQKGMGGTTAFWNHYFSN
LVYDFHTQQQKGLLLFYEKAYEEGFLPKPIESIKIWGDVRTHHSSLM
Download sequence
Identical sequences Q9KCC1
WP_010897814.1.28103 gi|15614215|ref|NP_242518.1| 272558.BH1652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]